Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM134B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
| Antigen | FAM134B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15992420
|
Novus Biologicals
NBP15992420UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP159924
|
Novus Biologicals
NBP159924 |
100 μL |
Each for $487.50
|
|
|||||
Description
FAM134B Polyclonal specifically detects FAM134B in Human samples. It is validated for Western Blot.Specifications
| FAM134B | |
| Polyclonal | |
| Rabbit | |
| Q9H6L5 | |
| 54463 | |
| Synthetic peptides corresponding to FAM134B(family with sequence similarity 134, member B) The peptide sequence was selected from the middle region of FAM134B. Peptide sequence DFGIGEYINQKKRERSEADKEKSHKDDSELDFSALCPKISLTVAAKELSV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FAM134B protein, family with sequence similarity 134, member B, FLJ20152, FLJ22155, FLJ22179, HSAN2B, JK1 | |
| FAM134B | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title