Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. FAM134C Antibody, Novus Biologicals™

FAM134C Antibody, Novus Biologicals™
SDP

Catalog No. NBP16010420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16010420 20 μL
NBP160104 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16010420 Supplier Novus Biologicals Supplier No. NBP16010420UL

Description

Rabbit Polyclonal Antibody

FAM134C Polyclonal specifically detects FAM134C in Human samples. It is validated for Western Blot.

Specifications

Antigen FAM134C
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q86VR2
Gene Alias DKFZp686B1036, family with sequence similarity 134, member C, FLJ33806, hypothetical protein LOC162427
Gene Symbols FAM134C
Host Species Rabbit
Immunogen Synthetic peptides corresponding to FAM134C(family with sequence similarity 134, member C) The peptide sequence was selected from the N terminal of FAM134C. Peptide sequence EAAQRALVEVLGPYEPLLSRVQAALVWERPARSALWCLGLNAAFWFFALT.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 162427
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.