FAM13B1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25795125UL

Catalog No. NB393699

Description

FAM13B1 Polyclonal specifically detects FAM13B1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FAM13B1
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: C5orf5, chromosome 5 open reading frame 5, DKFZp667F249, FAM13B1, family with sequence similarity 13, member B, family with sequence similarity 13, member B1, FLJ26735, GAP-like protein N61, hypothetical protein LOC51306, KHCHP, MGC57159, N61
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51306
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: FAM13B
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YSLLKFLCRFLANVASHHEEIWSANSLAAVFGPDVFHIYTDVEDMKEQEIVSRIMAGLLENYYEFFENEEEDFSSNDLSSI
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only