Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM13B1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | FAM13B1 |
---|---|
Dilution | Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
FAM13B1 Polyclonal specifically detects FAM13B1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
FAM13B1 | |
Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
C5orf5, chromosome 5 open reading frame 5, DKFZp667F249, FAM13B1, family with sequence similarity 13, member B, family with sequence similarity 13, member B1, FLJ26735, GAP-like protein N61, hypothetical protein LOC51306, KHCHP, MGC57159, N61 | |
FAM13B | |
IgG | |
Affinity Purified |
Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Rabbit | |
Human | |
51306 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YSLLKFLCRFLANVASHHEEIWSANSLAAVFGPDVFHIYTDVEDMKEQEIVSRIMAGLLENYYEFFENEEEDFSSNDLSSI | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title