Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. FAM13C1 Antibody, Novus Biologicals™

FAM13C1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP156524 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP156524 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP156524 Supplier Novus Biologicals Supplier No. NBP156524
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

FAM13C1 Polyclonal specifically detects FAM13C1 in Human samples. It is validated for Western Blot.

Specifications

Antigen FAM13C1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8NE31
Gene Alias FAM13C1, family with sequence similarity 13, member C, hypothetical protein LOC220965, member C1, MGC33233
Gene Symbols FAM13C
Host Species Rabbit
Immunogen Synthetic peptides corresponding to FAM13C1(family with sequence similarity 13, member C1) The peptide sequence was selected from the N terminal of FAM13C1. Peptide sequence TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 220965
Test Specificity Expected identity based on immunogen sequence: Mouse: 100%; Human: 100%; Rat: 92%;.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.