Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM163B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25715725UL
Description
FAM163B Polyclonal specifically detects FAM163B in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
FAM163B | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
C9orf166, Chromosome 9 Open Reading Frame 166, Family With Sequence Similarity 163, Member B, Protein FAM163B | |
Rabbit | |
Affinity Purified | |
RUO | |
642968 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
FAM163B | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EEEPDFAVHSHLPPLHSNRNLVLTNGPALYPTASTSFSQKSPQARALCRSCSHCEPPTFFLQEPPEEEEDVLNGGERVLYKSVSQE | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction