Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM168A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17406720UL
Description
FAM168A Polyclonal specifically detects FAM168A in Mouse samples. It is validated for Western Blot.Specifications
FAM168A | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q68FE1 | |
FAM168A | |
Synthetic peptides corresponding to the N terminal of Fam168a. Immunizing peptide sequence NSPSYAPATLLMKQAWPQNSSSCGTEGTFHLPVDTGTENRTYQASSAAFR. | |
Affinity Purified | |
RUO | |
23201 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
family with sequence similarity 168, member A, hypothetical protein LOC23201, KIAA0280TCRP1Tongue cancer chemotherapy resistance-associated protein 1 | |
Rabbit | |
26 kDa | |
20 μL | |
Primary | |
Mouse | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction