Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM168A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | FAM168A |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP17406720
![]() |
Novus Biologicals
NBP17406720UL |
20 μL |
Each for $206.00
|
|
|||||
NBP174067
![]() |
Novus Biologicals
NBP174067 |
100 μL |
Each for $487.50
|
|
|||||
Description
FAM168A Polyclonal specifically detects FAM168A in Mouse samples. It is validated for Western Blot.Specifications
FAM168A | |
Polyclonal | |
Rabbit | |
Q68FE1 | |
23201 | |
Synthetic peptides corresponding to the N terminal of Fam168a. Immunizing peptide sequence NSPSYAPATLLMKQAWPQNSSSCGTEGTFHLPVDTGTENRTYQASSAAFR. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
family with sequence similarity 168, member A, hypothetical protein LOC23201, KIAA0280TCRP1Tongue cancer chemotherapy resistance-associated protein 1 | |
FAM168A | |
IgG | |
26 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title