Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM200A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16007720UL
Description
FAM200A Polyclonal specifically detects FAM200A in Human samples. It is validated for Western Blot.Specifications
FAM200A | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q8TCP9 | |
FAM200A | |
Synthetic peptides corresponding to FAM200A The peptide sequence was selected from the middle region of FAM200A. Peptide sequence QTFNYYFPEEKFESLKENIWMKDPFAFQNPESIIELNLEPEEENELLQLS. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
C7orf38, chromosome 7 open reading frame 38, DKFZp727G131, family with sequence similarity 200, member A, FLJ36794, hypothetical protein LOC221786 | |
Rabbit | |
Affinity Purified | |
RUO | |
221786 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction