Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FAM200A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	FAM200A
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP16007720 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP16007720UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP160077 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP160077	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

FAM200A Polyclonal specifically detects FAM200A in Human samples. It is validated for Western Blot.

Specifications

Antigen	FAM200A
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q8TCP9
Gene ID (Entrez)	221786
Immunogen	Synthetic peptides corresponding to FAM200A The peptide sequence was selected from the middle region of FAM200A. Peptide sequence QTFNYYFPEEKFESLKENIWMKDPFAFQNPESIIELNLEPEEENELLQLS.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	C7orf38, chromosome 7 open reading frame 38, DKFZp727G131, family with sequence similarity 200, member A, FLJ36794, hypothetical protein LOC221786
Gene Symbols	FAM200A
Isotype	IgG

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

FAM200A Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents