Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. FAM216B Antibody, Novus Biologicals™

FAM216B Antibody, Novus Biologicals™
SDP

Catalog No. NBP15776720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15776720 20 μL
NBP157767 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15776720 Supplier Novus Biologicals Supplier No. NBP15776720UL

Description

Rabbit Polyclonal Antibody

FAM216B Polyclonal specifically detects FAM216B in Human samples. It is validated for Western Blot.

Specifications

Antigen FAM216B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8N7L0
Gene Alias C13orf30, chromosome 13 open reading frame 30, FLJ40919, hypothetical protein LOC144809, MGC138442
Gene Symbols FAM216B
Host Species Rabbit
Immunogen Synthetic peptides corresponding to FAM216B The peptide sequence was selected from the N terminal of FAM216B 50ug). Peptide sequence MGQNWKRQQKLWNVPQLPFIRVPPSIYDTSLLKALNQGQQRYFYSIMRIY.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 144809
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.