Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FAM21A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $646.00

Specifications

Antigen	FAM21A
Applications	Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP259796 View Documents View Product Certificates	Novus Biologicals NBP259796	100 μL	Each for $646.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB393131 View Documents View Product Certificates	Novus Biologicals NBP25979625UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

FAM21A Polyclonal specifically detects FAM21A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	FAM21A
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Alias	Alternative Protein FAM21B, BA56A21.1, bA98I6.1, FAM21B, Family With Sequence Similarity 21 Member A, Family With Sequence Similarity 21, Member A, Family With Sequence Similarity 21, Member B, WASH Complex Subunit FAM21A, WASH Complex Subunit FAM21B
Gene Symbols	WASHC2A
Isotype	IgG
Purification Method	Protein A purified

Applications	Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Rabbit
Target Species	Human
Gene ID (Entrez)	387680
Immunogen	This antibody was developed against a recombinant protein corresponding to the amino acid sequence:VRVYDEEVEEPVLKAEAEKTEQEKTREQKEVDLIPKVQEAVNYGLQVLDSAFEQLDIKAGNSDSEEDDANGRVELILEPKDLYIDRPLPYLIGSKLFME
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only (RUO)

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

FAM21A Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents