FAM46D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156728

Catalog No. NBP156728

Description

FAM46D Polyclonal specifically detects FAM46D in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FAM46D
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: cancer/testis antigen 112, CT1.26, CT112, family with sequence similarity 46, member D, hypothetical protein LOC169966, MGC26999
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 169966
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8NEK8
• Gene Symbols: FAM46D
• Immunogen: Synthetic peptides corresponding to FAM46D(family with sequence similarity 46, member D) The peptide sequence was selected from the middle region of FAM46D. Peptide sequence LPNTQKVTCFYQPAPYFAAEARYPIYVIPEPPPVSFQPYHPLHFRGSNGM.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%.
• Target Species: Human, Pig, Bovine, Canine
• Isotype: IgG