Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM55D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP174206
Description
FAM55D Polyclonal specifically detects FAM55D in Mouse samples. It is validated for Western Blot.Specifications
FAM55D | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
C11orf33, chromosome 11 open reading frame 33, family with sequence similarity 55, member D, FLJ20127, hypothetical protein LOC54827 | |
Rabbit | |
Affinity purified | |
RUO | |
54827 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q52KP5 | |
NXPE4 | |
Synthetic peptides corresponding to the C terminal of Fam55d. Immunizing peptide sequence NSDVERFSDFHGYTQYLALKDIFQDLNVGVIDAWDMTVAYGINNVHPPED. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Bovine: 92%; Equine: 92%; Pig: 92%; Rabbit: 92%; Canine: 84%; Mouse: 84%. | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction