Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM55D Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | FAM55D |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17420620
|
Novus Biologicals
NBP17420620UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP174206
|
Novus Biologicals
NBP174206 |
100 μL |
Each for $487.50
|
|
|||||
Description
FAM55D Polyclonal specifically detects FAM55D in Mouse samples. It is validated for Western Blot.Specifications
| FAM55D | |
| Polyclonal | |
| Rabbit | |
| Q52KP5 | |
| 54827 | |
| Synthetic peptides corresponding to the C terminal of Fam55d. Immunizing peptide sequence NSDVERFSDFHGYTQYLALKDIFQDLNVGVIDAWDMTVAYGINNVHPPED. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C11orf33, chromosome 11 open reading frame 33, family with sequence similarity 55, member D, FLJ20127, hypothetical protein LOC54827 | |
| NXPE4 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title