Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FAM55D Antibody, Novus Biologicals™
SDP

Catalog No. NBP17420620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17420620 20 μL
NBP174206 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17420620 Supplier Novus Biologicals Supplier No. NBP17420620UL

Rabbit Polyclonal Antibody

FAM55D Polyclonal specifically detects FAM55D in Mouse samples. It is validated for Western Blot.

Specifications

Antigen FAM55D
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q52KP5
Gene Alias C11orf33, chromosome 11 open reading frame 33, family with sequence similarity 55, member D, FLJ20127, hypothetical protein LOC54827
Gene Symbols NXPE4
Host Species Rabbit
Immunogen Synthetic peptides corresponding to the C terminal of Fam55d. Immunizing peptide sequence NSDVERFSDFHGYTQYLALKDIFQDLNVGVIDAWDMTVAYGINNVHPPED.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54827
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.