FAM72A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25979025UL

Catalog No. NB393134

Description

FAM72A Polyclonal specifically detects FAM72A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FAM72A
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: Family With Sequence Similarity 72 Member A, Family With Sequence Similarity 72, Member A, Latent Membrane Protein 1-Induced Protein, LMP1-Induced Protein, LMPIP, Protein FAM72A, Ugene
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 729533
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: FAM72A
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acid sequence:CVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFT
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only (RUO)