Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FAM72A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	FAM72A
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP259790 View Documents View Product Certificates	Novus Biologicals NBP259790	100 μL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB393134 View Documents View Product Certificates	Novus Biologicals NBP25979025UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

FAM72A Polyclonal specifically detects FAM72A in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	FAM72A
Conjugate	Unconjugated
Host Species	Rabbit
Target Species	Human
Gene ID (Entrez)	729533
Immunogen	This antibody was developed against a recombinant protein corresponding to the amino acid sequence:CVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCYFT
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Alias	Family With Sequence Similarity 72 Member A, Family With Sequence Similarity 72, Member A, Latent Membrane Protein 1-Induced Protein, LMP1-Induced Protein, LMPIP, Protein FAM72A, Ugene
Gene Symbols	FAM72A
Isotype	IgG
Purification Method	Protein A purified

For Research Use Only (RUO)

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

FAM72A Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents