Learn More
Description
Specifications
Specifications
| Antigen | FAM83D |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | C20orf129, CHICA, Chromosome 20 Open Reading Frame 129, dJ616B8.3, Family With Sequence Similarity 83, Member D, Protein FAM83D, Spindle Protein CHICA |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM83D (NP_112181). Peptide sequence HFQSSNKFDHLTNRKPQSKELTLGNLLRMRLARLSSTPRKADLDPEMPAE |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
