Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM83D Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP309713100UL
Description
FAM83D Polyclonal specifically detects FAM83D in Human samples. It is validated for Western Blot.Specifications
FAM83D | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
C20orf129, CHICA, Chromosome 20 Open Reading Frame 129, dJ616B8.3, Family With Sequence Similarity 83, Member D, Protein FAM83D, Spindle Protein CHICA | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM83D (NP_112181). Peptide sequence HFQSSNKFDHLTNRKPQSKELTLGNLLRMRLARLSSTPRKADLDPEMPAE | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
81610 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction