Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAM83D Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FAM83D |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
FAM83D Polyclonal specifically detects FAM83D in Human samples. It is validated for Western Blot.Specifications
FAM83D | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
C20orf129, CHICA, Chromosome 20 Open Reading Frame 129, dJ616B8.3, Family With Sequence Similarity 83, Member D, Protein FAM83D, Spindle Protein CHICA | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM83D (NP_112181). Peptide sequence HFQSSNKFDHLTNRKPQSKELTLGNLLRMRLARLSSTPRKADLDPEMPAE | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
81610 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title