FANCD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257171

Catalog No. NBP257171

Description

FANCD2 Polyclonal specifically detects FANCD2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: FANCD2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: DKFZp762A223, FA4, FACD, FAD, FAD2, FA-D2, FADFAD2, FANCD, Fanconi anemia complementation group D2, Fanconi anemia group D2 protein, Fanconi anemia, complementation group D2, FLJ23826, FPN1, HFE4, IREG1, Protein FACD2, SLC11A3
• Host Species: Rabbit
• Molecular Weight of Antigen: 164.1 kDa
• Quantity: 100 μL
• Research Discipline: Breast Cancer, Cancer, DNA Double Strand Break Repair, DNA Repair, Epigenetics, Genes Sensitive to DNA Damaging Agents
• Gene ID (Entrez): 2177
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: FANCD2
• Immunogen: This FANCD2 Antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISELREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFD
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only