FARP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257178

Catalog No. NBP257178

Description

FARP2 Polyclonal specifically detects FARP2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: FARP2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: FERM, RhoGEF and pleckstrin domain protein 2, FGD1-related Cdc42-GEF, FIRFERM domain including RhoGEF, FRG, KIAA0793PH domain-containing family C member 3, Pleckstrin homology domain-containing family C member 3, PLEKHC3FERM, RhoGEF and pleckstrin domain-containing protein 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9855
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: FARP2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VEESDNEWSVPHCFTIYAAQKTIVVAASTRLEKEKWMLDLNSAIQAAKSGGDTAPALPGRTVCTRPPRSPNEVSLEQESEDDARGVR
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only