Fascin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174212

Catalog No. NBP174212

Description

Fascin Polyclonal specifically detects Fascin in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Fascin
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q61553
• Gene Symbols: FSCN1
• Immunogen: Synthetic peptides corresponding to the N terminal of Fscn1. Immunizing peptide sequence VVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQSVSPAEKWSVHIAMHPQV.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Bovine: 92%; Chicken: 85%; Zebrafish: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FAN1,55 kDa actin-bundling protein, fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus), FLJ38511, HSN, p55actin bundling protein, singed (Drosophila)-like (sea urchin fascin homolog like), singed-like (fascin homolog, sea urchin), Singed-like protein, SNLfascin
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6624
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.