Fascin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258042

Catalog No. NBP258042

Description

Fascin Polyclonal specifically detects Fascin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Fascin
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: FAN1,55 kDa actin-bundling protein, fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus), FLJ38511, HSN, p55actin bundling protein, singed (Drosophila)-like (sea urchin fascin homolog like), singed-like (fascin homolog, sea urchin), Singed-like protein, SNLfascin
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: FSCN1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GEHGFIGCRKVTGTLDANRSSYDVFQLEFNDGAYNIKDSTGKYWTVGSDSAVTSSGDTPVDFFFEFCDYNKVAIKVGGRYLKGDHAGVLKASAETVDP
• Quantity: 100 μL
• Research Discipline: Cytoskeleton Markers
• Gene ID (Entrez): 6624
• Target Species: Human
• Isotype: IgG

For Research Use Only