Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Fascin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	Fascin
Dilution	Immunohistochemistry-Paraffin 1:20 - 1:50
Applications	Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP258042 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP258042	100 μL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB403310 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP25804225UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

Fascin Polyclonal specifically detects Fascin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	Fascin
Applications	Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene ID (Entrez)	6624
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GEHGFIGCRKVTGTLDANRSSYDVFQLEFNDGAYNIKDSTGKYWTVGSDSAVTSSGDTPVDFFFEFCDYNKVAIKVGGRYLKGDHAGVLKASAETVDP
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Dilution	Immunohistochemistry-Paraffin 1:20 - 1:50
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Cytoskeleton Markers
Gene Alias	FAN1,55 kDa actin-bundling protein, fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus), FLJ38511, HSN, p55actin bundling protein, singed (Drosophila)-like (sea urchin fascin homolog like), singed-like (fascin homolog, sea urchin), Singed-like protein, SNLfascin
Gene Symbols	FSCN1
Isotype	IgG
Purification Method	Affinity Purified

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Fascin Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents