Fast skeletal myosin light chain 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP26262525UL

Catalog No. NB393068

Description

Fast skeletal myosin light chain 2 Polyclonal antibody specifically detects Fast skeletal myosin light chain 2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Fast skeletal myosin light chain 2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: DKFZp779C0757, Fast skeletal myosin light chain 2, HUMMLC2B, MGC13450, MLC2B, MRLC2, MYL11, myosin light chain 2, myosin light chain, phosphorylatable, fast skeletal muscle, myosin regulatory light chain 2, skeletal muscle isoform, myosin, light chain 11, regulatory
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KGTIKKKFLEELLTTQCDRFSQEEIKNMWAAF
• Quantity: 25 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 29895
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG