Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FAT10 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen FAT10
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15833720
View Documents
Novus Biologicals
NBP15833720UL
20 μL
Each for $152.22
Add to cart
 
NBP158337
View Documents
Novus Biologicals
NBP158337
100 μL
Each for $436.00
Add to cart
 
Description

Description

FAT10 Polyclonal specifically detects FAT10 in Human samples. It is validated for Western Blot.
Specifications

Specifications

FAT10
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
Diubiquitin, FAT10diubiquitin, GABBR1, UBD-3, ubiquitin D, Ubiquitin-like protein FAT10
UBD
IgG
Affinity Purified
18 kDa
Western Blot
Unconjugated
RUO
O15205
10537
Synthetic peptides corresponding to UBD(ubiquitin D) The peptide sequence was selected from the N terminal of UBD. Peptide sequence RSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEE.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit