Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FAT10 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | FAT10 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15833720
|
Novus Biologicals
NBP15833720UL |
20 μL |
Each for $152.22
|
|
NBP158337
|
Novus Biologicals
NBP158337 |
100 μL |
Each for $436.00
|
|
Description
FAT10 Polyclonal specifically detects FAT10 in Human samples. It is validated for Western Blot.Specifications
FAT10 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Diubiquitin, FAT10diubiquitin, GABBR1, UBD-3, ubiquitin D, Ubiquitin-like protein FAT10 | |
UBD | |
IgG | |
Affinity Purified | |
18 kDa |
Western Blot | |
Unconjugated | |
RUO | |
O15205 | |
10537 | |
Synthetic peptides corresponding to UBD(ubiquitin D) The peptide sequence was selected from the N terminal of UBD. Peptide sequence RSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEE. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title