FATP3/SLC27A3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159839

Catalog No. NBP159839

Description

FATP3/SLC27A3 Polyclonal specifically detects FATP3/SLC27A3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FATP3/SLC27A3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 6.2.1, EC 6.2.1.-, EC 6.2.1.7, FATP-3, FATP3ACSVL3MGC4365, Fatty acid transport protein 3, long-chain fatty acid transport protein 3, solute carrier family 27 (fatty acid transporter), member 3, Solute carrier family 27 member 3, Very long-chain acyl-CoA synthetase homolog 3, VLCS-3
• Host Species: Rabbit
• Molecular Weight of Antigen: 79 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5K4L6
• Gene Symbols: SLC27A3
• Immunogen: Synthetic peptides corresponding to SLC27A3 (solute carrier family 27 (fatty acid transporter), member 3) The peptide sequence was selected from the middle region of SLC27A3)(50ug). Peptide sequence PFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGP The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 11000
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep
• Isotype: IgG