Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Fbl14 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $349.40
Specifications
| Antigen | Fbl14 |
|---|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human FBXL14. Peptide sequence WRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQILSLRRSLSY. |
| Host Species | Rabbit |
| Primary or Secondary | Primary |
| Monoclonal or Polyclonal | Polyclonal |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17952020
|
Novus Biologicals
NBP17952020UL |
20ul |
Each for $152.22
|
|
NBP179520
|
Novus Biologicals
NBP179520 |
100 ul |
Each for $349.40
|
|
Description
Fbl14 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.Specifications
| Fbl14 | |
| Rabbit | |
| Polyclonal | |
| Unconjugated | |
| 144699 | |
| Affinity Purified | |
| Western Blot | |
| RUO |
| Synthetic peptide directed towards the N terminal of human FBXL14. Peptide sequence WRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQILSLRRSLSY. | |
| Primary | |
| IgG | |
| FBL14, F-box and leucine-rich repeat protein 14 | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| Immunogen affinity purified | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title