Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Fbl14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
| Antigen | Fbl14 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17952020
|
Novus Biologicals
NBP17952020UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP179520
|
Novus Biologicals
NBP179520 |
100 μL |
Each for $499.50
|
|
|||||
Description
Fbl14 Polyclonal specifically detects Fbl14 in Human samples. It is validated for Western Blot.Specifications
| Fbl14 | |
| Polyclonal | |
| Rabbit | |
| NP_689654 | |
| 144699 | |
| Synthetic peptide directed towards the N terminal of human FBXL14. Peptide sequence WRDAAYHKSVWRGVEAKLHLRRANPSLFPSLQARGIRRVQILSLRRSLSY. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FBL14, F-box and leucine-rich repeat protein 14 | |
| FBXL14 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title