Fbx32 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179517

Catalog No. NBP179517

Description

Fbx32 Polyclonal specifically detects Fbx32 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Fbx32
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: atrogin 1, atrogin-1, ATROGIN1, F-box only protein 32, F-box protein 32, Fbx32, FLJ32424, MAFBX, MAFbxMGC33610, Muscle atrophy F-box protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 39 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence mouse 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_080622
• Gene Symbols: FBXO32
• Immunogen: Synthetic peptide directed towards the C terminal of human Fbxo32. Peptide sequence LVRCYPRREQYGVTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 114907
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.