Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Fbx32 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | Fbx32 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Fbx32 Polyclonal specifically detects Fbx32 in Mouse samples. It is validated for Western Blot.Specifications
Fbx32 | |
Polyclonal | |
Rabbit | |
NP_080622 | |
114907 | |
Synthetic peptide directed towards the C terminal of human Fbxo32. Peptide sequence LVRCYPRREQYGVTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDF. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
atrogin 1, atrogin-1, ATROGIN1, F-box only protein 32, F-box protein 32, Fbx32, FLJ32424, MAFBX, MAFbxMGC33610, Muscle atrophy F-box protein | |
FBXO32 | |
IgG | |
39 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title