FBXL16 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157613

Catalog No. NBP157613

Description

FBXL16 Polyclonal specifically detects FBXL16 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FBXL16
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C16orf22, c380A1.1, c380A1.1 (novel protein), chromosome 16 open reading frame 22, FBL16, F-box and leucine-rich repeat protein 16Fbl16, F-box/LRR-repeat protein 16, FLJ33735, MGC33974
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 146330
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8N461
• Gene Symbols: FBXL16
• Immunogen: Synthetic peptides corresponding to FBXL16(F-box and leucine-rich repeat protein 16) The peptide sequence was selected from the middle region of FBXL16. Peptide sequence GCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Equine: 91%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Zebrafish
• Isotype: IgG