Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FBXL16 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FBXL16 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FBXL16 Polyclonal specifically detects FBXL16 in Human samples. It is validated for Western Blot.Specifications
FBXL16 | |
Polyclonal | |
Rabbit | |
Q8N461 | |
146330 | |
Synthetic peptides corresponding to FBXL16(F-box and leucine-rich repeat protein 16) The peptide sequence was selected from the middle region of FBXL16. Peptide sequence GCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C16orf22, c380A1.1, c380A1.1 (novel protein), chromosome 16 open reading frame 22, FBL16, F-box and leucine-rich repeat protein 16Fbl16, F-box/LRR-repeat protein 16, FLJ33735, MGC33974 | |
FBXL16 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title