FBXO22 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155425

Catalog No. NBP155425

Description

FBXO22 Polyclonal specifically detects FBXO22 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FBXO22
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8NEZ5
• Gene Symbols: FBXO22
• Immunogen: Synthetic peptides corresponding to FBXO22(F-box protein 22) The peptide sequence was selected from the middle region of FBXO22. Peptide sequence CCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKYVLCASDFVCE.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26263
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: F-box only protein 22, F-box protein 22, F-box protein FBX22p44, FBX22FLJ13986, FIST domain containing 1, FISTC1, MGC31799
• Host Species: Rabbit
• Molecular Weight of Antigen: 30 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.