Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FBXO24 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15314120UL
Description
FBXO24 Polyclonal specifically detects FBXO24 in Human samples. It is validated for Western Blot.Specifications
FBXO24 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
O75426 | |
FBXO24 | |
Synthetic peptides corresponding to FBXO24(F-box protein 24) The peptide sequence was selected from the middle region of FBXO24. Peptide sequence EGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLPHLRVACMTSNQSSTLY. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
DKFZp434I1122, F-box protein 24, F-box protein Fbx24, FBX24F-box only protein 24 | |
Rabbit | |
Affinity Purified | |
RUO | |
26261 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction