Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. FBXO24 Antibody, Novus Biologicals™

FBXO24 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15314020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15314020 20 μL
NBP153140 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15314020 Supplier Novus Biologicals Supplier No. NBP15314020UL

Description

Rabbit Polyclonal Antibody

FBXO24 Polyclonal specifically detects FBXO24 in Human samples. It is validated for Western Blot.

Specifications

Antigen FBXO24
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. O75426
Gene Alias DKFZp434I1122, F-box protein 24, F-box protein Fbx24, FBX24F-box only protein 24
Gene Symbols FBXO24
Host Species Rabbit
Immunogen Synthetic peptides corresponding to FBXO24(F-box protein 24) The peptide sequence was selected from the N terminal of FBXO24. Peptide sequence VCDGEGVWRRICRRLSPRLQDQDTKGLYFQAFGGRRRCLSKSVAPLLAHG.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 26261
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.