Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FBXO24 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $501.50
Specifications
Antigen | FBXO24 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB5314120UL
![]() |
Novus Biologicals
NBP15314120UL |
20 μL |
Each for $206.00
|
|
|||||
NBP153141
![]() |
Novus Biologicals
NBP153141 |
100 μL |
Each for $501.50
|
|
|||||
Description
FBXO24 Polyclonal specifically detects FBXO24 in Human samples. It is validated for Western Blot.Specifications
FBXO24 | |
Polyclonal | |
Rabbit | |
O75426 | |
26261 | |
Synthetic peptides corresponding to FBXO24(F-box protein 24) The peptide sequence was selected from the middle region of FBXO24. Peptide sequence EGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLPHLRVACMTSNQSSTLY. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DKFZp434I1122, F-box protein 24, F-box protein Fbx24, FBX24F-box only protein 24 | |
FBXO24 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title