FBXO25 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155044

Catalog No. NBP155044

Description

FBXO25 Polyclonal specifically detects FBXO25 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FBXO25
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: F-box protein 25, F-box protein Fbx25, FBX25F-box only protein 25, MGC20256, MGC51975
• Host Species: Rabbit
• Molecular Weight of Antigen: 34 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8TCJ0
• Gene Symbols: FBXO25
• Immunogen: Synthetic peptides corresponding to FBXO25(F-box protein 25) The peptide sequence was selected from the N terminal of FBXO25. Peptide sequence LGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNIL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26260
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG