Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FBXO25 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen FBXO25
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP155044
SDP
View Documents
Novus Biologicals
NBP155044
100 μL
Each of 1 for $487.50
Only null left
Add to Cart
 
Description

Description

FBXO25 Polyclonal specifically detects FBXO25 in Human samples. It is validated for Western Blot.
Specifications

Specifications

FBXO25
Polyclonal
Rabbit
Q8TCJ0
26260
Synthetic peptides corresponding to FBXO25(F-box protein 25) The peptide sequence was selected from the N terminal of FBXO25. Peptide sequence LGEAFNRLDFSSAIQDIRRFNYVVKLLQLIAKSQLTSLSGVAQKNYFNIL.
Primary
Western Blot
Unconjugated
RUO
F-box protein 25, F-box protein Fbx25, FBX25F-box only protein 25, MGC20256, MGC51975
FBXO25
IgG
34 kDa
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.