FBXO28 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155341

Catalog No. NBP155341

Description

FBXO28 Polyclonal specifically detects FBXO28 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FBXO28
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: F-box only protein 28, F-box protein 28, FBX28, KIAA0483FLJ10766
• Host Species: Rabbit
• Molecular Weight of Antigen: 41 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Guinea pig: 86%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NVF7
• Gene Symbols: FBXO28
• Immunogen: Synthetic peptides corresponding to FBXO28(F-box protein 28) The peptide sequence was selected from the middle region of FBXO28. Peptide sequence ELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSKRLRNRK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23219
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.