Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FBXO28 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FBXO28 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FBXO28 Polyclonal specifically detects FBXO28 in Human samples. It is validated for Western Blot.Specifications
FBXO28 | |
Polyclonal | |
Rabbit | |
Q9NVF7 | |
23219 | |
Synthetic peptides corresponding to FBXO28(F-box protein 28) The peptide sequence was selected from the middle region of FBXO28. Peptide sequence ELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSKRLRNRK. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
F-box only protein 28, F-box protein 28, FBX28, KIAA0483FLJ10766 | |
FBXO28 | |
IgG | |
41 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title