Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FBXO28 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | FBXO28 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
FBXO28 Polyclonal specifically detects FBXO28 in Human samples. It is validated for Western Blot.Specifications
| FBXO28 | |
| Polyclonal | |
| Rabbit | |
| Q9NVF7 | |
| 23219 | |
| Synthetic peptides corresponding to FBXO28(F-box protein 28) The peptide sequence was selected from the middle region of FBXO28. Peptide sequence ELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSKRLRNRK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| F-box only protein 28, F-box protein 28, FBX28, KIAA0483FLJ10766 | |
| FBXO28 | |
| IgG | |
| 41 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title