Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FBXO3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15504620UL
Description
FBXO3 Polyclonal specifically detects FBXO3 in Human samples. It is validated for Western Blot.Specifications
FBXO3 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9UK99 | |
FBXO3 | |
Synthetic peptides corresponding to FBXO3(F-box protein 3) The peptide sequence was selected from the N terminal of FBXO3. Peptide sequence NCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQCWKSLFIDTYS. | |
Affinity Purified | |
RUO | |
26273 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
DKFZp564B092, F-box protein 3, F-box protein FBX3, FBX3FBAF-box only protein 3 | |
Rabbit | |
47 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction