Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FBXO8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15531720UL
Description
FBXO8 Polyclonal specifically detects FBXO8 in Human samples. It is validated for Western Blot.Specifications
FBXO8 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9NRD0 | |
FBXO8 | |
Synthetic peptides corresponding to FBXO8(F-box protein 8) The peptide sequence was selected from the middle region of FBXO8. Peptide sequence EFFRHIHAPEERGEYLETLITKFSHRFCACNPDLMRELGLSPDAVYVLCY. | |
Affinity Purified | |
RUO | |
26269 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
F-box only protein 8, F-box protein 8, F-box/SEC7 protein FBS, FBSFBX8F-box protein Fbx8 | |
Rabbit | |
37 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction