Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FBXO8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | FBXO8 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15531720
![]() |
Novus Biologicals
NBP15531720UL |
20 μL |
Each for $206.00
|
|
|||||
NBP155317
![]() |
Novus Biologicals
NBP155317 |
100 μL |
Each for $487.50
|
|
|||||
Description
FBXO8 Polyclonal specifically detects FBXO8 in Human samples. It is validated for Western Blot.Specifications
FBXO8 | |
Polyclonal | |
Rabbit | |
Q9NRD0 | |
26269 | |
Synthetic peptides corresponding to FBXO8(F-box protein 8) The peptide sequence was selected from the middle region of FBXO8. Peptide sequence EFFRHIHAPEERGEYLETLITKFSHRFCACNPDLMRELGLSPDAVYVLCY. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
F-box only protein 8, F-box protein 8, F-box/SEC7 protein FBS, FBSFBX8F-box protein Fbx8 | |
FBXO8 | |
IgG | |
37 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title