Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FBXO8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$208.00 - $487.50
Specifications
| Antigen | FBXO8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15531720
|
Novus Biologicals
NBP15531720UL |
20 μL |
Each for $208.00
|
|
|||||
|
NBP155317
|
Novus Biologicals
NBP155317 |
100 μL |
Each for $487.50
|
|
|||||
Description
FBXO8 Polyclonal specifically detects FBXO8 in Human samples. It is validated for Western Blot.Specifications
| FBXO8 | |
| Polyclonal | |
| Rabbit | |
| Q9NRD0 | |
| 26269 | |
| Synthetic peptides corresponding to FBXO8(F-box protein 8) The peptide sequence was selected from the middle region of FBXO8. Peptide sequence EFFRHIHAPEERGEYLETLITKFSHRFCACNPDLMRELGLSPDAVYVLCY. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| F-box only protein 8, F-box protein 8, F-box/SEC7 protein FBS, FBSFBX8F-box protein Fbx8 | |
| FBXO8 | |
| IgG | |
| 37 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title