FCRL1/FcRH1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP184703

Catalog No. NBP184703

Description

FCRL1/FcRH1 Polyclonal specifically detects FCRL1/FcRH1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: FCRL1/FcRH1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: CD307a antigen, Fc receptor homolog 1, Fc receptor-like 1, FcRH1, FCRH1DKFZp667O1421, FcRL1, FcR-like protein 1, hIFGP1, IFGP family protein 1, IFGP1Fc receptor-like protein 1, Immune receptor translocation-associated protein 5, IRTA5immunoglobulin superfamily Fc receptor, gp42
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 115350
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: FCRL1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:AMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSL
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only