Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP159061

FCRN/FCGRT Antibody, Novus Biologicals™
SDP

Catalog No. NBP159061 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159061 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159061 Supplier Novus Biologicals Supplier No. NBP159061
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

FCRN/FCGRT Polyclonal specifically detects FCRN/FCGRT in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen FCRN/FCGRT
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P55899
Gene Alias alpha-chain, Fc fragment of IgG, receptor, transporter, alpha, FcRn, FcRn alpha chain, FCRNimmunoglobulin receptor, intestinal, heavy chain, IgG Fc fragment receptor transporter alpha chain, IgG receptor FcRn large subunit p51, major histocompatibility complex class I-like Fc receptor, Neonatal Fc receptor, neonatal Fc-receptor for Ig
Gene Symbols FCGRT
Host Species Rabbit
Immunogen Synthetic peptides corresponding to FCGRT(Fc fragment of IgG, receptor, transporter, alpha) The peptide sequence was selected from the N terminal of FCGRT (NP_004098). Peptide sequence GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE.
Molecular Weight of Antigen 40 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Immunology
Primary or Secondary Primary
Gene ID (Entrez) 2217
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Bovine, Canine, Equine, Guinea Pig, Sheep
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.