Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

FECH Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15486320UL

 View more versions of this product

Catalog No. NBP15486320


Only null left
Add to Cart

Description

Description

FECH Polyclonal specifically detects FECH in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

FECH
Polyclonal
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Q8NAN0
FECH
Synthetic peptides corresponding to FECH(ferrochelatase (protoporphyria)) The peptide sequence was selected from the N terminal of FECH. Peptide sequence QHAQGAKPQVQPQKRYESNIRKPKTGILMLNMGGPETLGDVHDFLLRLFL.
20 μL
Lipid and Metabolism
2235
Store at -20C. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Unconjugated
PBS & 2% Sucrose. with No Preservative
EC 4.99.1.1, EPP, FCE, ferrochelatase, ferrochelatase (protoporphyria), ferrochelatase, mitochondrial, Heme synthase, heme synthetase, Protoheme ferro-lyase, protoporphyria
Rabbit
Affinity Purified
RUO
Primary
Human
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.