FERMT3/URP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25711025UL

Catalog No. NB394131

Description

FERMT3/URP2 Polyclonal specifically detects FERMT3/URP2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: FERMT3/URP2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: fermitin family member 3, KIND3fermitin family homolog 3 (Drosophila), kindlin 3, Kindlin-3, MGC10966, MIG-2, MIG2BURP2SF, MIG2-like protein, UNC-112 related protein 2, UNC112C, Unc-112-related protein 2, URP2fermitin family homolog 3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 83706
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: FERMT3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MADSSYTSEVQAILAFLSLQRTGSGGPGNHPHGPDASAEGLNPYGLVAPRFQRKFKAKQLT
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only