Ferric Chelate Reductase 1 Like Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25883625UL

Catalog No. NB435265

Description

Ferric Chelate Reductase 1 Like Polyclonal specifically detects Ferric Chelate Reductase 1 Like in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: C9orf4
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: FRRS1L
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RHDSSYGTFAGEFYDLRYLSEEGYPFPTAPPVDPFAKIKVDDCGKTKGCFRYGKPGCNAETC
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human Ferric Chelate Reductase 1 Like antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG

• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: Brain protein CG-6, C9orf4, CG6, CG-6, chromosome 9 open reading frame 4, ferric-chelate reductase 1-like, hypothetical protein LOC23732
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23732
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only