Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ferric Chelate Reductase 1 Like Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | C9orf4 |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Ferric Chelate Reductase 1 Like Polyclonal specifically detects Ferric Chelate Reductase 1 Like in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| C9orf4 | |
| Polyclonal | |
| Rabbit | |
| Brain protein CG-6, C9orf4, CG6, CG-6, chromosome 9 open reading frame 4, ferric-chelate reductase 1-like, hypothetical protein LOC23732 | |
| FRRS1L | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Unconjugated | |
| RUO | |
| 23732 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RHDSSYGTFAGEFYDLRYLSEEGYPFPTAPPVDPFAKIKVDDCGKTKGCFRYGKPGCNAETC | |
| Primary | |
| Specificity of human Ferric Chelate Reductase 1 Like antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title